PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.003G053300.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family MYB
Protein Properties Length: 270aa    MW: 28898 Da    PI: 5.0096
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.003G053300.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding49.87.6e-162269148
                          TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
       Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                          +g W++eEde+l   ++ +G  tW+++a+  g++R++k+c++rw +yl
  Sobic.003G053300.2.p 22 KGLWSPEEDERLFTQITYHGVSTWSSVAQLAGLRRSGKSCRLRWMNYL 69
                          678*******************************************97 PP

2Myb_DNA-binding45.51.7e-1477118346
                           SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
       Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                           + ++ E+e ++ + + lG++ W+tIa++m+ gRt++++k++w++
  Sobic.003G053300.2.p  77 PISKREEETIISLQQSLGNR-WSTIAARMP-GRTDNEIKNYWNS 118
                           56889***************.*********.***********95 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129421.9681773IPR017930Myb domain
SuperFamilySSF466891.57E-2721116IPR009057Homeodomain-like
SMARTSM007171.3E-102171IPR001005SANT/Myb domain
PfamPF002492.6E-132269IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.6E-202376IPR009057Homeodomain-like
CDDcd001674.21E-92569No hitNo description
SMARTSM007176.4E-1374122IPR001005SANT/Myb domain
PROSITE profilePS5129416.76974124IPR017930Myb domain
CDDcd001675.54E-1077117No hitNo description
PfamPF002493.8E-1277118IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.0E-2377124IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 270 aa     Download sequence    Send to blast
MVRKPIHADA GANGTEANKE RKGLWSPEED ERLFTQITYH GVSTWSSVAQ LAGLRRSGKS  60
CRLRWMNYLR PDLKKEPISK REEETIISLQ QSLGNRWSTI AARMPGRTDN EIKNYWNSRI  120
RKRLNAARDS TAKPAPAPAV GGEEGSANAA PPPADQHVPI PARFPVFGCQ LLDLDGAGGG  180
MSSAGSGSGE SPQSSTTTST QQNTGDESEA SVGGNSSGGG GGDDINMIHF LSFDDLDYYP  240
GDLLMDVPGA MDAWESELYS ANSMMSSLC*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C1e-242212427128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9715591e-170EU971559.1 Zea mays clone 367166 anthocyanin regulatory C1 protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001151654.11e-120anthocyanin regulatory C1 protein
TrEMBLK7UUG41e-121K7UUG4_MAIZE; Putative MYB DNA-binding domain superfamily protein
STRINGGRMZM2G143274_P011e-121(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP87032545
Representative plantOGRP1595433
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G09540.12e-47myb domain protein 61